PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc10g006880.2.1
Common NameNAC-NOR
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NAC
Protein Properties Length: 356aa    MW: 40265 Da    PI: 8.5803
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc10g006880.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM171.13.5e-53161431128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         lppGfrFhPtdeel+v+yLkk+v+g ++++ ++i e+d+yk++Pw+Lp+k+  +e+ew+fFs+rd+ky++g r+nra++sgyWkatg+dk+
  Solyc10g006880.2.1  16 LPPGFRFHPTDEELIVHYLKKRVAGAPIPV-DIIGEIDLYKFDPWELPAKAIFGEQEWFFFSPRDRKYPNGARPNRAATSGYWKATGTDKP 105
                         79****************************.99***************7777899************************************ PP

                 NAM  92 vlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                         v+++ ++++vg+kk Lvfy g+ pkg+kt+W+mheyr+
  Solyc10g006880.2.1 106 VFTSgGTQKVGVKKALVFYGGKPPKGVKTNWIMHEYRV 143
                         **9977788***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.01E-6411179IPR003441NAC domain
PROSITE profilePS5100561.36716179IPR003441NAC domain
PfamPF023651.0E-2717143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MESTDSSTGT RHQPQLPPGF RFHPTDEELI VHYLKKRVAG APIPVDIIGE IDLYKFDPWE  60
LPAKAIFGEQ EWFFFSPRDR KYPNGARPNR AATSGYWKAT GTDKPVFTSG GTQKVGVKKA  120
LVFYGGKPPK GVKTNWIMHE YRVVENKTNN KPLGCDNIVA NKKGSLRLDD WVLCRIYKKN  180
NTQRSIDDLH DMLGSIPQNV PNSILQGIKP SNYGTILLEN ESNMYDGIMN NTNDIINNNN  240
RSIPQISSKR TMHGGLYWNN DEATTTTTTI DRNHSPNTKR FLVENNEDDG LNMNNISRIT  300
NHEQSSSIAN FLSQFPQNPS IQQQQQQQEE VLGSLNDGVV FRQPYNQVTG MNWYS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-751318214168NO APICAL MERISTEM PROTEIN
1ut4_B2e-751318214168NO APICAL MERISTEM PROTEIN
1ut7_A2e-751318214168NO APICAL MERISTEM PROTEIN
1ut7_B2e-751318214168NO APICAL MERISTEM PROTEIN
3swm_A2e-751318217171NAC domain-containing protein 19
3swm_B2e-751318217171NAC domain-containing protein 19
3swm_C2e-751318217171NAC domain-containing protein 19
3swm_D2e-751318217171NAC domain-containing protein 19
3swp_A2e-751318217171NAC domain-containing protein 19
3swp_B2e-751318217171NAC domain-containing protein 19
3swp_C2e-751318217171NAC domain-containing protein 19
3swp_D2e-751318217171NAC domain-containing protein 19
4dul_A2e-751318214168NAC domain-containing protein 19
4dul_B2e-751318214168NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.156200.0fruit
Function -- GeneRIF ? help Back to Top
  1. The susceptibility of ripe fruit to the necrotrophic pathogen Botrytis cinerea is dependent on NOR but not on RIN.
    [PMID: 543708]
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5738020.0Lycopersicon esculentum NAC domain protein (NAC-NOR) mRNA, complete cds
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001234652.10.0NAC domain protein
SwissprotQ9LD441e-107NAC56_ARATH; NAC transcription factor 56
TrEMBLQ56UP70.0Q56UP7_SOLLC; NAC domain protein
STRINGSolyc10g006880.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA18142466
Representative plantOGRP1715800
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15510.11e-105NAC domain containing protein 2
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]